LL-37 – Antimicrobial and Immune Support Peptide for Research

Price range: $65.00 through $189.00

Product Information;

Name: LL-37 humam; LL-37; CAP-18; Cathelicidin; ropocamptide
CAS No.: 154947-66-7
Peptide Sequence: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
Molecular Formula: C205H340N60O53
Molecular Weight: 4493.26
Appearance: White Lyophilized powder

🧬 LL-37 Peptide – Antimicrobial and Immunomodulatory Research Peptide;

1. Introduction

LL-37 peptide is a naturally occurring antimicrobial peptide derived from the human cathelicidin protein (hCAP18). It plays a vital role in the body’s innate immune defense system, acting as a first-line barrier against bacteria, viruses, and fungi.

In research environments, LL-37 is recognized for its antimicrobial, anti-inflammatory, and tissue-regenerative properties. It’s commonly studied in fields like microbiology, immunology, wound healing, and inflammation biology.

As a research compound, LL-37 peptide is for laboratory use only and is not approved for medical or therapeutic use.


2. What Is LL-37 Peptide?

LL-37 is the only human cathelicidin peptide identified to date. It is generated when the precursor protein, hCAP18, is cleaved during immune response activation.

In its natural form, LL-37 circulates in various tissues, including skin, respiratory tract, and immune cells, where it contributes to defense against microbial invaders.

In laboratory settings, synthetic LL-37 peptide is used to study:

  • Antimicrobial signaling mechanisms

  • Tissue regeneration and wound healing

  • Immune cell modulation

  • Inflammation and cytokine balance

These properties make LL-37 one of the most versatile research peptides in the study of human immunity and infection control.


3. Chemical Profile and Physical Properties

Property Specification
Peptide Name LL-37 (Human Cathelicidin)
Sequence [LL-37, 37 aa]
Molecular Formula C₂₀₃H₃₁₈N₅₆O₄₀
Molecular Weight ≈ 4493.3 g/mol
Appearance White/off-white lyophilized powder
Purity (Research Grade) ≥ 98% (HPLC verified)
Solubility Water, PBS, or mild acetic acid
Storage −20 °C, desiccated, and light-protected
Stability 24 months (lyophilized)

4. Mechanism of Action

LL-37 exhibits both direct antimicrobial and immune-modulating activity.

a) Antimicrobial Action

LL-37 disrupts bacterial cell membranes, leading to cell lysis. It acts against gram-positive and gram-negative bacteria, fungi, and even some viruses.

b) Immunomodulation

LL-37 influences immune cell behavior by:

  • Regulating cytokine release

  • Enhancing macrophage and neutrophil activation

  • Supporting tissue regeneration and angiogenesis

c) Wound Healing and Repair

In research, LL-37 has shown potential to:

  • Stimulate keratinocyte migration

  • Enhance collagen synthesis

  • Promote vascular repair and epithelial closure

Its dual action—antimicrobial defense and healing support—makes LL-37 a valuable peptide for inflammation and tissue recovery studies.


5. Research Applications

While LL-37 is not approved for clinical use, it is extensively explored across multiple scientific disciplines.

🧫 1. Antimicrobial Research

LL-37 is a cornerstone peptide in host defense studies, used to examine mechanisms of bacterial resistance and innate immunity.

💪 2. Immune System Modulation

LL-37 is studied for its role in immune regulation, influencing cytokines such as IL-6 and TNF-α.

🩹 3. Wound Healing and Regeneration

Its capacity to promote cell migration, collagen production, and angiogenesis makes it key in tissue repair research.

🧠 4. Inflammatory Conditions

LL-37 may help regulate inflammatory signaling in autoimmune and infection models, helping scientists understand chronic inflammation.

🦠 5. Biofilm and Microbial Defense Studies

Because of its biofilm-disrupting effects, LL-37 is a frequent subject in antimicrobial resistance research.

⚠️ Note: LL-37 peptide is for research use only. It is not for human or veterinary use.


6. Advantages in Research

Feature Benefit to Researchers
Broad-spectrum antimicrobial Effective against bacteria, fungi, and viruses
Immunomodulatory activity Balances immune response and inflammation
Supports tissue healing Enhances epithelial repair and angiogenesis
Stable synthetic form High reproducibility and purity for lab use
Multi-field relevance Used in microbiology, immunology, and dermatology studies

7. Handling and Storage

To preserve LL-37 peptide’s stability and performance:

  • Storage: Keep lyophilized powder at −20 °C, sealed, and moisture-free.

  • Reconstitution: Use sterile water or phosphate-buffered saline (PBS).

  • Handling: Avoid repeated freeze–thaw cycles.

  • Labeling: Clearly marked “For Research Use Only – Not for Human Use.”

  • Shelf Life: 24 months (unopened, lyophilized).


8. Selecting High-Quality LL-37 Peptide

When sourcing LL-37 peptide for laboratory research, ensure:

  1. ≥ 98% purity verified by HPLC or LC-MS.

  2. Certificate of Analysis (COA) available for each lot.

  3. Proper labeling and compliance with research-use standards.

  4. Temperature-controlled packaging during shipping.

  5. Transparent synthesis details from a reputable supplier.

High-quality synthesis ensures consistent biological performance in experiments.


9. FAQs – LL-37 Peptide Research

Q1. What is LL-37 peptide?
LL-37 is a human cathelicidin-derived antimicrobial peptide that helps defend against pathogens and supports tissue repair in research models.

Q2. What is LL-37 used for in research?
It is studied for its roles in antimicrobial defense, immune modulation, and wound healing.

Q3. Is LL-37 naturally found in humans?
Yes. It’s the only known human cathelicidin peptide, produced by immune and epithelial cells.

Q4. Can LL-37 be used therapeutically?
No. It is strictly for research use and not approved for medical or clinical applications.

Q5. How is LL-37 stored?
Store at −20 °C, dry and dark, to maintain long-term stability.


10. Summary

LL-37 peptide is one of the most dynamic research peptides known for its antimicrobial and immune-modulating potential. As the only human cathelicidin-derived peptide, it plays a vital role in defense, healing, and immune balance.

In research laboratories, LL-37 continues to provide valuable insights into infection control, skin regeneration, and immune response regulation, making it an indispensable molecule for modern biomedical studies.

Disclaimer: LL-37 peptide is for research and laboratory use only. It is not approved for human or veterinary use.